All Primary Antibodies
All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (113)
- (334)
- (11)
- (1)
- (3)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (4)
- (2)
- (2)
- (2)
- (438)
- (14)
- (97)
- (345)
- (1)
- (2)
- (4)
- (10)
- (16)
- (23)
- (12)
- (4)
- (1)
- (5)
- (9)
- (4)
- (429)
- (4)
- (245)
- (21)
- (1)
- (12)
- (7)
- (184)
- (1)
- (1)
- (10)
- (5)
- (2)
- (40)
- (51)
- (178)
- (29)
- (51)
- (18)
- (2)
- (204)
- (2)
- (73)
- (1)
- (1)
- (1)
- (409)
Filtered Search Results
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | NP_079968 |
Antigen | UFM1 Activating Enzyme/UBA5 |
Gene Symbols | UBA5 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 44 kDa |
Gene Alias | FLJ17281, FLJ23251UBA5, ThiFP1, UBE1DC1ubiquitin-activating enzyme E1 homolog, ubiquitin-like modifier activating enzyme 5, ubiquitin-like modifier-activating enzyme 5, UFM1-activating enzyme |
Gene ID (Entrez) | 79876 |
Immunogen | The immunogen for this antibody is Uba5 - N-terminal region. Peptide sequence LLFDYDKVELANMNRLFFQPYQAGLSKVHAAEHTLRNINPDVLFEVHNYN. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Human |
Host Species | Goat |
Conjugate | Unconjugated |
Applications | Western Blot,Immunoprecipitation |
Isotype | IgG |
Gene Accession No. | Q8NBJ7 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 2/SUMF2 |
Gene Symbols | SUMF2 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.1 ug/mL, Immunoprecipitation 25 ug/mL |
Gene Alias | C-alpha-formyglycine-generating enzyme 2, C-alpha-formylglycine-generating enzyme 2, DKFZp566I1024, DKFZp686I1024, DKFZp686L17160, DKFZp781L1035, FGE2, MGC99485, paralog of the formylglycine-generating enzyme, pFGE, sulfatase modifying factor 2, sulfatase-modifying factor 2 |
Gene ID (Entrez) | 25870 |
Immunogen | Mouse myeloma cell line NS0-derived recombinant human Sulfatase Modifying Factor 2/SUMF2 Gln26-Leu301 Accession # Q8NBJ7 |
Classification | Polyclonal |
Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects human Sulfatase Modifying Factor 2/SUMF2 in direct ELISAs and Western blots. In direct ELISAs and Western blots, approximately 45% cross-reactivity with recombinant mouse SUMF2 is observed and less than 1% cross-reactivity with recombinant human SUMF1 is observed. |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Mouse |
Host Species | Goat |
Conjugate | Unconjugated |
Applications | Western Blot,Immunoprecipitation |
Isotype | IgG |
Gene Accession No. | Q8BPG6 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 2/SUMF2 |
Gene Symbols | SUMF2 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.1 ug/mL, Immunoprecipitation 25 ug/mL |
Gene Alias | C-alpha-formyglycine-generating enzyme 2, C-alpha-formylglycine-generating enzyme 2, DKFZp566I1024, DKFZp686I1024, DKFZp686L17160, DKFZp781L1035, FGE2, MGC99485, paralog of the formylglycine-generating enzyme, pFGE, sulfatase modifying factor 2, sulfatase-modifying factor 2 |
Gene ID (Entrez) | 25870 |
Immunogen | Mouse myeloma cell line NS0-derived recombinant mouse Sulfatase Modifying Factor 2/SUMF2 Gln34-Leu308 Accession # Q8BPG6 |
Classification | Polyclonal |
Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects mouse Sulfatase Modifying Factor 2/SUMF2 in direct ELISAs and Western blots. In direct ELISAs and Western blots, approximately 10% cross-reactivity with recombinant human (rh) SUMF2 and less than 5% cross-reactivity with rhSUMF1 is observed. |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Mouse |
Host Species | Rat |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG2a |
Gene Accession No. | Q8BPG6 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 2/SUMF2 |
Gene Symbols | SUMF2 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified from hybridoma culture supernatant |
Dilution | Western Blot 1 ug/mL |
Gene Alias | C-alpha-formyglycine-generating enzyme 2, C-alpha-formylglycine-generating enzyme 2, DKFZp566I1024, DKFZp686I1024, DKFZp686L17160, DKFZp781L1035, FGE2, MGC99485, paralog of the formylglycine-generating enzyme, pFGE, sulfatase modifying factor 2, sulfatase-modifying factor 2 |
Gene ID (Entrez) | 25870 |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
Immunogen | Mouse myeloma cell line NS0-derived recombinant mouse Sulfatase Modifying Factor 2/SUMF2 Gln34-Leu308 Accession # Q8BPG6 |
Classification | Monoclonal |
Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects mouse Sulfatase Modifying Factor 2/SUMF2 in direct ELISAs and Western blots. In Western blots, no cross-reactivity with recombinant human SUMF2 or recombinant mouse SUMF1 is observed. |
Clone | 382407 |
Antigen | UFM1 Activating Enzyme/UBA5 |
---|---|
Gene Symbols | UBA5 |
Regulatory Status | RUO |
Gene Alias | FLJ17281, FLJ23251UBA5, ThiFP1, UBE1DC1ubiquitin-activating enzyme E1 homolog, ubiquitin-like modifier activating enzyme 5, ubiquitin-like modifier-activating enzyme 5, UFM1-activating enzyme |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Gene ID (Entrez) | 79876 |
Immunogen | Synthetic peptides corresponding to UBA5(ubiquitin-like modifier activating enzyme 5) The peptide sequence was selected from the middle region of UBA5. Peptide sequence VLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACF. |
Classification | Polyclonal |
Isotype | IgG |
Gene Accession No. | Q9GZZ9 |
Primary or Secondary | Primary |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Immunoprecipitation |
Form | Purified |
Isotype | IgG2b |
Gene Accession No. | Q8NBJ7 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 2/SUMF2 |
Gene Symbols | SUMF2 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified from hybridoma culture supernatant |
Dilution | Western Blot 1 ug/mL, Immunoprecipitation 25 ug/mL |
Gene Alias | C-alpha-formyglycine-generating enzyme 2, C-alpha-formylglycine-generating enzyme 2, DKFZp566I1024, DKFZp686I1024, DKFZp686L17160, DKFZp781L1035, FGE2, MGC99485, paralog of the formylglycine-generating enzyme, pFGE, sulfatase modifying factor 2, sulfatase-modifying factor 2 |
Gene ID (Entrez) | 25870 |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
Immunogen | Mouse myeloma cell line NS0-derived recombinant human Sulfatase Modifying Factor 2/SUMF2 Gln26-Leu301 Accession # Q8NBJ7 |
Classification | Monoclonal |
Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects human Sulfatase Modifying Factor 2/SUMF2 in direct ELISAs and Western blots. No cross-reactivity with recombinant human SUMF1 or recombinant mouse SUMF2 is observed. |
Clone | 330312 |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Human,Mouse |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Immunoprecipitation |
Form | Purified |
Isotype | IgG2b |
Gene Accession No. | Q8NBK3.3 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 1/SUMF1 |
Gene Symbols | SUMF1 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified from hybridoma culture supernatant |
Dilution | Western Blot 1 ug/mL, Immunoprecipitation 25 ug/mL |
Gene Alias | AAPA3037, EC 1.8.99.-, FGE1, FGEC-alpha-formylglycine-generating enzyme 1, FGly-generating enzyme, MGC131853, MGC150436, sulfatase modifying factor 1, sulfatase-modifying factor 1, UNQ3037 |
Gene ID (Entrez) | 285362 |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
Immunogen | Mouse myeloma cell line NS0-derived recombinant human Sulfatase Modifying Factor 1/SUMF1 isoform 1 Ser34-Asp374 (Ser63Asn) Accession # Q8NBK3.3 |
Classification | Monoclonal |
Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects recombinant human or mouse Sulfatase Modifying Factor 1/SUMF1 in direct ELISAs and Western blots. In direct ELISAs and Western blots, no cross-reactivity with recombinant human SUMF2 or recombinant mouse SUMF2 is observed. |
Clone | 329005 |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Mouse |
Host Species | Goat |
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | Q8R0F3 |
Concentration | LYOPH |
Antigen | Sulfatase Modifying Factor 1/SUMF1 |
Gene Symbols | SUMF1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.1 ug/mL |
Gene Alias | AAPA3037, EC 1.8.99.-, FGE1, FGEC-alpha-formylglycine-generating enzyme 1, FGly-generating enzyme, MGC131853, MGC150436, sulfatase modifying factor 1, sulfatase-modifying factor 1, UNQ3037 |
Gene ID (Entrez) | 285362 |
Immunogen | Mouse myeloma cell line NS0-derived recombinant mouse Sulfatase Modifying Factor 1/SUMF1 Ser32-Asp372 Accession # Q8R0F3 |
Classification | Polyclonal |
Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects mouse Sulfatase Modifying Factor 1/SUMF1 in direct ELISAs and Western blots. In direct ELISAs and Western blots, approximately 50% cross-reactivity with recombinant human SUMF1 is observed and 10% cross-reactivity with recombinant mouse SUMF2 is observed. |